PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8899_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 153aa    MW: 16993.4 Da    PI: 8.8238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8899_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-183784148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  cra_locus_8899_iso_2_len_607_ver_3 37 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 84
                                        79******************************************9996 PP

2Myb_DNA-binding25.14.1e-0890120132
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
                     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg 32 
                                         +g++T++E+ +++++++++G++ W++ a+++ 
  cra_locus_8899_iso_2_len_607_ver_3  90 KGAFTADEERRIIELHAKMGNK-WARMAAEVC 120
                                         799*******************.*****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.3463288IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-243587IPR009057Homeodomain-like
SMARTSM007171.7E-133686IPR001005SANT/Myb domain
PfamPF002495.6E-163784IPR001005SANT/Myb domain
SuperFamilySSF466896.68E-2538114IPR009057Homeodomain-like
CDDcd001678.17E-113984No hitNo description
PROSITE profilePS500906.28485124IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.5E-1488120IPR009057Homeodomain-like
SMARTSM007171.0E-489133IPR001005SANT/Myb domain
PfamPF002494.2E-790121IPR001005SANT/Myb domain
CDDcd001670.0062292127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MTRENEDQMV NKGGISSPSA EEGSGGGNVG GSGPLKKGPW TSAEDAILVE YVTKHGEGNW  60
NAVQKHSGLA RCGKSCRLRW ANHLRPDLKK GAFTADEERR IIELHAKMGN KWARMAAEVC  120
TSCRLCFLFQ QIKHTFKDIC SVALQYYIFL SYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-213511625105MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080497.11e-65PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_011080498.11e-65PREDICTED: transcription factor GAMYB-like isoform X2
RefseqXP_011080499.11e-65PREDICTED: transcription factor GAMYB-like isoform X2
SwissprotA2WW872e-55GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A068UQ748e-70A0A068UQ74_COFCA; Uncharacterized protein
STRINGSolyc06g073640.2.15e-61(Solanum lycopersicum)